PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G106700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 108aa    MW: 12422.2 Da    PI: 10.3187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G106700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.73.6e-20956148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd+ll ++v+++G g+W+t+ar  g++R  k+c++rw +yl
  Aqcoe1G106700.1.p  9 KGPWTAEEDKLLTEYVTLHGEGRWSTVARSAGLNRNNKSCRLRWVNYL 56
                       79********************************************97 PP

2Myb_DNA-binding43.19.7e-1462101142
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                        rg  T+eE+ +++++++ +G++ W+ Iar+++ gRt++++k+
  Aqcoe1G106700.1.p  62 RGQLTPEEESIIIELHAVWGNK-WSMIARCLP-GRTDNEIKN 101
                        7888******************.*********.*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.234160IPR017930Myb domain
SuperFamilySSF466891.12E-316101IPR009057Homeodomain-like
SMARTSM007175.9E-15858IPR001005SANT/Myb domain
PfamPF002498.4E-17956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241063IPR009057Homeodomain-like
CDDcd001672.60E-101156No hitNo description
SMARTSM007171.4E-461104IPR001005SANT/Myb domain
PROSITE profilePS5129413.7361107IPR017930Myb domain
PfamPF002498.1E-1162101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2064101IPR009057Homeodomain-like
CDDcd001677.58E-866101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
KNHSQGWRKG PWTAEEDKLL TEYVTLHGEG RWSTVARSAG LNRNNKSCRL RWVNYLRPGL  60
KRGQLTPEEE SIIIELHAVW GNKWSMIARC LPGRTDNEIK NLSIFIH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-249101798B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430947.15e-57hypothetical protein CICLE_v10013466mg, partial
RefseqXP_007032859.16e-57Myb domain protein 121
RefseqXP_010113169.15e-57Transcription factor
SwissprotP813911e-44MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A061EFJ97e-57A0A061EFJ9_THECC; Myb domain protein 121
TrEMBLV4STY96e-57V4STY9_9R
TrEMBLW9SN565e-57W9SN56_9R
STRINGSolyc02g089190.1.15e-55(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.12e-56myb domain protein 121